Icon representing a puzzle

2492: Revisiting Puzzle 68: Bos Taurus

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
August 07, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This cow protein, found in epithelial cells of the intestine, binds calcium as it moves from the digestive tract into the blood. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
KSPEELKGIFEKYAAKEGDPNQLSKEELKLLLQTEFPSLLKGGSTLDELFEELDKNGDGEVSFEEFQVLVKKISQ

Top groups

  1. Avatar for Window Group 11. Window Group 1 pt. 5,522
  1. Avatar for osc 61. osc Lv 1 1 pt. 8,949
  2. Avatar for Kimdonghyeon 62. Kimdonghyeon Lv 1 1 pt. 7,121
  3. Avatar for jflat06 63. jflat06 Lv 1 1 pt. 5,522
  4. Avatar for dmoaddeli 64. dmoaddeli Lv 1 1 pt. 5,380
  5. Avatar for Eclegv 65. Eclegv Lv 1 1 pt. 5,079
  6. Avatar for SmoothCB 66. SmoothCB Lv 1 1 pt. 4,903
  7. Avatar for pockey123987 67. pockey123987 Lv 1 1 pt. 4,858

Comments