Placeholder image of a protein
Icon representing a puzzle

2496: Electron Density Reconstruction 101

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
August 09, 2024
Expires
Max points
100
Description

The structure of this protein-DNA complex has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. You may notice that there’s a base pair in here that doesn’t look normal; it’s a Hoogsteen base pair (as opposed to Watson-Crick). Later on, we’ll ask you to play another version of this puzzle where it’s been put in as Watson-Crick instead of Hoogsteen as we’d like to see which works better. Also, a reminder that DNA sidechains can be turned relative to their blue arms with bands.

Sequence
ACTGGTTACTCTTTAATGTAT ATACATTAAAGAGTAACCAGT GPPILKELENLSPEEAAHQKAVVETLLQEDPWRVAKMVKSYLQQHNIPQREVVDTTGLNQSHLSQHLNKGTPMKTQKRAALYTWYVRKQREVAQQFTHAGQGGLIEEPTGDELPTKKGRRNRFKWGPASQQILFQAYERQKNPSKEERETLVEECNRAECIQRGVSPSQAQGLGSNLVTEVRVYNWFANRRKEEAFRH

Top groups

  1. Avatar for Extraterrestrials 2.0 11. Extraterrestrials 2.0 1 pt. 47,868
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 45,822
  1. Avatar for blazegeek 41. blazegeek Lv 1 1 pt. 47,489
  2. Avatar for Vinara 42. Vinara Lv 1 1 pt. 47,461
  3. Avatar for Merf 43. Merf Lv 1 1 pt. 47,250
  4. Avatar for spvincent 44. spvincent Lv 1 1 pt. 47,179
  5. Avatar for Mohoernchen 45. Mohoernchen Lv 1 1 pt. 46,786
  6. Avatar for rinze 46. rinze Lv 1 1 pt. 46,686
  7. Avatar for lilshorty 47. lilshorty Lv 1 1 pt. 46,559
  8. Avatar for WuWTq 48. WuWTq Lv 1 1 pt. 46,554
  9. Avatar for Swapper242 49. Swapper242 Lv 1 1 pt. 46,508
  10. Avatar for brennan 50. brennan Lv 1 1 pt. 46,490

Comments