Placeholder image of a protein
Icon representing a puzzle

2499: Electron Density Reconstruction 102

Closed since over 1 year ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
August 14, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. For this first round of this puzzle, we won't have the Refine Density tool active. It is a bit large, so the Trim tool may be necessary.

Sequence
NLLQFNKMIKEETGKNAIPFYAFYGCYCGGGGNGKPKDGTDRCCFVHDCCYGRLVNCNTKSDIYSYSLKEGYITCGKGTNCEEQICECDRVAAECFRRNLDTYNNGYMFYRDSKCTETSEEC

Top groups


  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 108,554
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 105,039
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 57,305
  4. Avatar for Extraterrestrials 2.0 14. Extraterrestrials 2.0 1 pt. 54,913
  5. Avatar for incognito group 15. incognito group 1 pt. 53,891

  1. Avatar for drumpeter18yrs9yrs 21. drumpeter18yrs9yrs Lv 1 14 pts. 114,012
  2. Avatar for JuliaBCollet 22. JuliaBCollet Lv 1 12 pts. 113,991
  3. Avatar for Gerom 23. Gerom Lv 1 11 pts. 113,981
  4. Avatar for Trajan464 24. Trajan464 Lv 1 9 pts. 113,657
  5. Avatar for carsonfb 25. carsonfb Lv 1 8 pts. 113,543
  6. Avatar for akaaka 26. akaaka Lv 1 7 pts. 113,479
  7. Avatar for nancy_naniewoo 27. nancy_naniewoo Lv 1 6 pts. 113,341
  8. Avatar for ProfVince 28. ProfVince Lv 1 6 pts. 113,220
  9. Avatar for spvincent 29. spvincent Lv 1 5 pts. 113,156
  10. Avatar for BarrySampson 30. BarrySampson Lv 1 4 pts. 112,903

Comments