Placeholder image of a protein
Icon representing a puzzle

2499: Electron Density Reconstruction 102

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
August 14, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. For this first round of this puzzle, we won't have the Refine Density tool active. It is a bit large, so the Trim tool may be necessary.

Sequence
NLLQFNKMIKEETGKNAIPFYAFYGCYCGGGGNGKPKDGTDRCCFVHDCCYGRLVNCNTKSDIYSYSLKEGYITCGKGTNCEEQICECDRVAAECFRRNLDTYNNGYMFYRDSKCTETSEEC

Top groups

  1. Avatar for Gargleblasters 11. Gargleblasters 1 pt. 108,554
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 105,039
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 57,305
  4. Avatar for Extraterrestrials 2.0 14. Extraterrestrials 2.0 1 pt. 54,913
  5. Avatar for incognito group 15. incognito group 1 pt. 53,891
  1. Avatar for rosie4loop 51. rosie4loop Lv 1 1 pt. 104,111
  2. Avatar for Larini 52. Larini Lv 1 1 pt. 102,039
  3. Avatar for Kimdonghyeon 53. Kimdonghyeon Lv 1 1 pt. 100,936
  4. Avatar for pruneau_44 54. pruneau_44 Lv 1 1 pt. 84,412
  5. Avatar for Hellcat6 55. Hellcat6 Lv 1 1 pt. 67,252
  6. Avatar for Sammy3c2b1a0 56. Sammy3c2b1a0 Lv 1 1 pt. 57,305
  7. Avatar for zanbato 57. zanbato Lv 1 1 pt. 54,913
  8. Avatar for Daniel Gross 58. Daniel Gross Lv 1 1 pt. 53,891
  9. Avatar for ingoneato 59. ingoneato Lv 1 1 pt. 53,891
  10. Avatar for mirrorbase 60. mirrorbase Lv 1 1 pt. 53,891

Comments