Placeholder image of a protein
Icon representing a puzzle

2499: Electron Density Reconstruction 102

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
August 14, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. For this first round of this puzzle, we won't have the Refine Density tool active. It is a bit large, so the Trim tool may be necessary.

Sequence
NLLQFNKMIKEETGKNAIPFYAFYGCYCGGGGNGKPKDGTDRCCFVHDCCYGRLVNCNTKSDIYSYSLKEGYITCGKGTNCEEQICECDRVAAECFRRNLDTYNNGYMFYRDSKCTETSEEC

Top groups

  1. Avatar for L'Alliance Francophone
    1. L'Alliance Francophone
    100 pts. 115,760
  2. Avatar for Go Science 2. Go Science 70 pts. 115,733
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 47 pts. 115,690
  4. Avatar for Contenders 4. Contenders 30 pts. 115,492
  5. Avatar for Marvin's bunch 5. Marvin's bunch 19 pts. 115,362
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 11 pts. 115,042
  7. Avatar for Australia 7. Australia 7 pts. 114,996
  8. Avatar for Void Crushers 8. Void Crushers 4 pts. 114,411
  9. Avatar for VeFold 9. VeFold 2 pts. 113,991
  10. Avatar for Russian team 10. Russian team 1 pt. 113,981
  1. Avatar for hada 31. hada Lv 1 4 pts. 112,355
  2. Avatar for Anfinsen_slept_here 32. Anfinsen_slept_here Lv 1 3 pts. 111,729
  3. Avatar for Alistair69 33. Alistair69 Lv 1 3 pts. 110,584
  4. Avatar for maithra 34. maithra Lv 1 2 pts. 109,916
  5. Avatar for Mohoernchen 35. Mohoernchen Lv 1 2 pts. 109,430
  6. Avatar for Th1sN@me!sN0tAPun 36. Th1sN@me!sN0tAPun Lv 1 2 pts. 109,414
  7. Avatar for DScott 37. DScott Lv 1 2 pts. 108,863
  8. Avatar for Merf 38. Merf Lv 1 1 pt. 108,815
  9. Avatar for zbp 39. zbp Lv 1 1 pt. 108,703
  10. Avatar for KRUK94 40. KRUK94 Lv 1 1 pt. 108,660

Comments