Placeholder image of a protein
Icon representing a puzzle

2499: Electron Density Reconstruction 102

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
August 14, 2024
Expires
Max points
100
Description

The structure of this protein has already been solved and published, but close inspection suggests that there are some problems with the published solution. We'd like to see if Foldit players can use the same electron density data to reconstruct a better model. For this first round of this puzzle, we won't have the Refine Density tool active. It is a bit large, so the Trim tool may be necessary.

Sequence
NLLQFNKMIKEETGKNAIPFYAFYGCYCGGGGNGKPKDGTDRCCFVHDCCYGRLVNCNTKSDIYSYSLKEGYITCGKGTNCEEQICECDRVAAECFRRNLDTYNNGYMFYRDSKCTETSEEC

Top groups

  1. Avatar for L'Alliance Francophone
    1. L'Alliance Francophone
    100 pts. 115,760
  2. Avatar for Go Science 2. Go Science 70 pts. 115,733
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 47 pts. 115,690
  4. Avatar for Contenders 4. Contenders 30 pts. 115,492
  5. Avatar for Marvin's bunch 5. Marvin's bunch 19 pts. 115,362
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 11 pts. 115,042
  7. Avatar for Australia 7. Australia 7 pts. 114,996
  8. Avatar for Void Crushers 8. Void Crushers 4 pts. 114,411
  9. Avatar for VeFold 9. VeFold 2 pts. 113,991
  10. Avatar for Russian team 10. Russian team 1 pt. 113,981
  1. Avatar for mwm64 41. mwm64 Lv 1 1 pt. 108,554
  2. Avatar for carxo 42. carxo Lv 1 1 pt. 108,422
  3. Avatar for pizpot 43. pizpot Lv 1 1 pt. 108,042
  4. Avatar for Arne Heessels 44. Arne Heessels Lv 1 1 pt. 107,508
  5. Avatar for rinze 45. rinze Lv 1 1 pt. 107,477
  6. Avatar for Swapper242 46. Swapper242 Lv 1 1 pt. 106,643
  7. Avatar for Idiotboy 47. Idiotboy Lv 1 1 pt. 105,251
  8. Avatar for deathbat_87 48. deathbat_87 Lv 1 1 pt. 105,228
  9. Avatar for alyssa_d_V2.0 49. alyssa_d_V2.0 Lv 1 1 pt. 105,039
  10. Avatar for Dr.Sillem 50. Dr.Sillem Lv 1 1 pt. 104,677

Comments