Placeholder image of a protein
Icon representing a puzzle

2501: Refine Density Reconstruction 4

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
August 28, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2137, which was Reconstruction Puzzle 7, but now we have the Refine Density tool available to make folds even better! Learn about the new tool here: https://fold.it/forum/blog/new-tool-refine-density. This one won't allow loading solutions from that puzzle.

Sequence
TAAAKFERQHMDSPDLGTDDDDKAMADIGSDFMLSQEFFNSFITIYRPYLKLTEPILEKHNIYYGQWLILRDIAKHQPTTLIEISHRRAIEKPTARKTLKALIENDLITVENSLEDKRQKFLTLTPKGHELYEIVCLDVQKLQQAVVAKTNISQDQMQETINVMNQIHEILLKEAHND

Top groups

  1. Avatar for Void Crushers 11. Void Crushers 1 pt. 17,356
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 14,529
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 13,681
  1. Avatar for WBarme1234 11. WBarme1234 Lv 1 49 pts. 19,371
  2. Avatar for fpc 12. fpc Lv 1 45 pts. 19,340
  3. Avatar for gmn 13. gmn Lv 1 42 pts. 19,330
  4. Avatar for Punzi Baker 3 14. Punzi Baker 3 Lv 1 39 pts. 19,209
  5. Avatar for alcor29 15. alcor29 Lv 1 36 pts. 19,095
  6. Avatar for AlkiP0Ps 16. AlkiP0Ps Lv 1 33 pts. 19,084
  7. Avatar for rosie4loop 17. rosie4loop Lv 1 30 pts. 19,083
  8. Avatar for blazegeek 18. blazegeek Lv 1 28 pts. 18,940
  9. Avatar for BarrySampson 19. BarrySampson Lv 1 25 pts. 18,864
  10. Avatar for akaaka 20. akaaka Lv 1 23 pts. 18,862

Comments