Icon representing a puzzle

2502: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
August 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for Extraterrestrials 2.0 11. Extraterrestrials 2.0 1 pt. 10,404
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 10,101
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 9,652
  1. Avatar for fpc 11. fpc Lv 1 46 pts. 10,681
  2. Avatar for Bletchley Park 12. Bletchley Park Lv 1 42 pts. 10,680
  3. Avatar for grogar7 13. grogar7 Lv 1 38 pts. 10,670
  4. Avatar for Galaxie 14. Galaxie Lv 1 35 pts. 10,642
  5. Avatar for SemperRabbit 15. SemperRabbit Lv 1 32 pts. 10,625
  6. Avatar for christioanchauvin 16. christioanchauvin Lv 1 29 pts. 10,606
  7. Avatar for alcor29 17. alcor29 Lv 1 27 pts. 10,605
  8. Avatar for AlkiP0Ps 18. AlkiP0Ps Lv 1 24 pts. 10,572
  9. Avatar for BarrySampson 19. BarrySampson Lv 1 22 pts. 10,565
  10. Avatar for TheGUmmer 20. TheGUmmer Lv 1 20 pts. 10,557

Comments