Icon representing a puzzle

2502: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
August 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for Extraterrestrials 2.0 11. Extraterrestrials 2.0 1 pt. 10,404
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 10,101
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 9,652
  1. Avatar for AlphaFold2 31. AlphaFold2 Lv 1 6 pts. 10,380
  2. Avatar for Th1sN@me!sN0tAPun 32. Th1sN@me!sN0tAPun Lv 1 5 pts. 10,371
  3. Avatar for davidoskky 33. davidoskky Lv 1 5 pts. 10,361
  4. Avatar for Vinara 34. Vinara Lv 1 4 pts. 10,360
  5. Avatar for Idiotboy 35. Idiotboy Lv 1 4 pts. 10,350
  6. Avatar for Anfinsen_slept_here 36. Anfinsen_slept_here Lv 1 3 pts. 10,336
  7. Avatar for orily1337 37. orily1337 Lv 1 3 pts. 10,334
  8. Avatar for rosie4loop 38. rosie4loop Lv 1 2 pts. 10,323
  9. Avatar for Dr.Sillem 39. Dr.Sillem Lv 1 2 pts. 10,271
  10. Avatar for nicobul 40. nicobul Lv 1 2 pts. 10,231

Comments