Icon representing a puzzle

2502: Revisiting Puzzle 70: Nucleosome Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
August 29, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein domain is a component of the histone protein complex, which packages DNA into compact units called nucleosomes. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
PHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Top groups

  1. Avatar for Extraterrestrials 2.0 11. Extraterrestrials 2.0 1 pt. 10,404
  2. Avatar for Gargleblasters 12. Gargleblasters 1 pt. 10,101
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 9,652
  1. Avatar for NameGoes 61. NameGoes Lv 1 1 pt. 9,761
  2. Avatar for Green4 62. Green4 Lv 1 1 pt. 9,701
  3. Avatar for nancy_naniewoo 63. nancy_naniewoo Lv 1 1 pt. 9,678
  4. Avatar for Merf 64. Merf Lv 1 1 pt. 9,675
  5. Avatar for Swapper242 65. Swapper242 Lv 1 1 pt. 9,674
  6. Avatar for ivalnic 66. ivalnic Lv 1 1 pt. 9,663
  7. Avatar for Sammy3c2b1a0 67. Sammy3c2b1a0 Lv 1 1 pt. 9,652
  8. Avatar for Kimdonghyeon 68. Kimdonghyeon Lv 1 1 pt. 9,639
  9. Avatar for jldowninClown 69. jldowninClown Lv 1 1 pt. 8,828

Comments