Icon representing a puzzle

2505: Revisiting Puzzle 71: Crystallin

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
September 04, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,263
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 11,245
  3. Avatar for Contenders 3. Contenders 47 pts. 11,168
  4. Avatar for Australia 4. Australia 30 pts. 11,145
  5. Avatar for Extraterrestrials 2.0 5. Extraterrestrials 2.0 19 pts. 11,053
  6. Avatar for VeFold 6. VeFold 11 pts. 10,973
  7. Avatar for Marvin's bunch 7. Marvin's bunch 7 pts. 10,945
  8. Avatar for Team China 8. Team China 4 pts. 10,851
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 2 pts. 10,821
  10. Avatar for FamilyBarmettler 10. FamilyBarmettler 1 pt. 10,791
  1. Avatar for AlkiP0Ps 11. AlkiP0Ps Lv 1 46 pts. 11,145
  2. Avatar for ichwilldiesennamen 12. ichwilldiesennamen Lv 1 42 pts. 11,137
  3. Avatar for Punzi Baker 3 13. Punzi Baker 3 Lv 1 39 pts. 11,130
  4. Avatar for blazegeek 14. blazegeek Lv 1 36 pts. 11,114
  5. Avatar for zanbato 15. zanbato Lv 1 33 pts. 11,053
  6. Avatar for BootsMcGraw 16. BootsMcGraw Lv 1 30 pts. 11,046
  7. Avatar for akaaka 17. akaaka Lv 1 27 pts. 11,032
  8. Avatar for alcor29 18. alcor29 Lv 1 25 pts. 11,017
  9. Avatar for Galaxie 19. Galaxie Lv 1 23 pts. 10,992
  10. Avatar for JuliaBCollet 20. JuliaBCollet Lv 1 20 pts. 10,973

Comments