Icon representing a puzzle

2505: Revisiting Puzzle 71: Crystallin

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
September 04, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in high concentrations in the lens of the eye. Among its other functions, it is responsible for the high refractive index (and resulting optical properties) of the lens. The protein is modeled here in reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
MYKIQIFEKGDFNGQMHETTEDCPSIMEQFHMREVHSCKVLEGAWIFYELPNYRGRQYLLDKKEYRKPVDWGAASPAVQSFRRIVE

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 11,263
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 70 pts. 11,245
  3. Avatar for Contenders 3. Contenders 47 pts. 11,168
  4. Avatar for Australia 4. Australia 30 pts. 11,145
  5. Avatar for Extraterrestrials 2.0 5. Extraterrestrials 2.0 19 pts. 11,053
  6. Avatar for VeFold 6. VeFold 11 pts. 10,973
  7. Avatar for Marvin's bunch 7. Marvin's bunch 7 pts. 10,945
  8. Avatar for Team China 8. Team China 4 pts. 10,851
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 2 pts. 10,821
  10. Avatar for FamilyBarmettler 10. FamilyBarmettler 1 pt. 10,791
  1. Avatar for BarrySampson 21. BarrySampson Lv 1 19 pts. 10,965
  2. Avatar for fpc 22. fpc Lv 1 17 pts. 10,945
  3. Avatar for rosie4loop 23. rosie4loop Lv 1 15 pts. 10,860
  4. Avatar for Zhang Ruichong 24. Zhang Ruichong Lv 1 14 pts. 10,851
  5. Avatar for drumpeter18yrs9yrs 25. drumpeter18yrs9yrs Lv 1 12 pts. 10,832
  6. Avatar for christioanchauvin 26. christioanchauvin Lv 1 11 pts. 10,821
  7. Avatar for Dr.Sillem 27. Dr.Sillem Lv 1 10 pts. 10,817
  8. Avatar for zbp 28. zbp Lv 1 9 pts. 10,801
  9. Avatar for WBarme1234 29. WBarme1234 Lv 1 8 pts. 10,791
  10. Avatar for turbolag 30. turbolag Lv 1 7 pts. 10,656

Comments