Placeholder image of a protein
Icon representing a puzzle

2514: Refine Density Reconstruction 8

Closed since over 1 year ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
September 19, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2237, which was Reconstruction Puzzle 19, but now we have the Refine Density tool available to make folds even better!

Sequence
MLPPLPDFSLSVEQQFDLQKYRQQVRDISREDLEDLFIEVVRQKMAHENIFKGMIRQGS

Top groups


  1. Avatar for Go Science 100 pts. 25,059
  2. Avatar for Contenders 2. Contenders 68 pts. 24,682
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 44 pts. 24,248
  4. Avatar for Void Crushers 4. Void Crushers 27 pts. 23,898
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 23,661
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 23,414
  7. Avatar for Marvin's bunch 7. Marvin's bunch 5 pts. 22,877
  8. Avatar for VeFold 8. VeFold 3 pts. 22,677
  9. Avatar for Australia 9. Australia 1 pt. 22,535
  10. Avatar for Russian team 10. Russian team 1 pt. 22,407

  1. Avatar for grogar7 11. grogar7 Lv 1 45 pts. 23,589
  2. Avatar for WBarme1234 12. WBarme1234 Lv 1 41 pts. 23,414
  3. Avatar for Aubade01 13. Aubade01 Lv 1 38 pts. 23,342
  4. Avatar for blazegeek 14. blazegeek Lv 1 35 pts. 23,273
  5. Avatar for dcrwheeler 15. dcrwheeler Lv 1 31 pts. 23,249
  6. Avatar for Punzi Baker 3 16. Punzi Baker 3 Lv 1 29 pts. 23,061
  7. Avatar for fpc 17. fpc Lv 1 26 pts. 22,877
  8. Avatar for alcor29 18. alcor29 Lv 1 24 pts. 22,681
  9. Avatar for manu8170 19. manu8170 Lv 1 21 pts. 22,680
  10. Avatar for BarrySampson 20. BarrySampson Lv 1 19 pts. 22,677

Comments