2514: Refine Density Reconstruction 8
Closed since over 1 year ago
Novice Overall Prediction Electron DensitySummary
- Created
- September 19, 2024
- Expires
- Max points
- 100
This is a protein we've given before in puzzle 2237, which was Reconstruction Puzzle 19, but now we have the Refine Density tool available to make folds even better!
- Sequence
- MLPPLPDFSLSVEQQFDLQKYRQQVRDISREDLEDLFIEVVRQKMAHENIFKGMIRQGS