Placeholder image of a protein
Icon representing a puzzle

2514: Refine Density Reconstruction 8

Closed since over 1 year ago

Novice Novice Novice Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
September 19, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2237, which was Reconstruction Puzzle 19, but now we have the Refine Density tool available to make folds even better!

Sequence
MLPPLPDFSLSVEQQFDLQKYRQQVRDISREDLEDLFIEVVRQKMAHENIFKGMIRQGS

Top groups


  1. Avatar for Go Science 100 pts. 25,059
  2. Avatar for Contenders 2. Contenders 68 pts. 24,682
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 44 pts. 24,248
  4. Avatar for Void Crushers 4. Void Crushers 27 pts. 23,898
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 16 pts. 23,661
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 23,414
  7. Avatar for Marvin's bunch 7. Marvin's bunch 5 pts. 22,877
  8. Avatar for VeFold 8. VeFold 3 pts. 22,677
  9. Avatar for Australia 9. Australia 1 pt. 22,535
  10. Avatar for Russian team 10. Russian team 1 pt. 22,407

  1. Avatar for bravosk8erboy
    1. bravosk8erboy Lv 1
    100 pts. 25,059
  2. Avatar for Bletchley Park 2. Bletchley Park Lv 1 93 pts. 24,555
  3. Avatar for LociOiling 3. LociOiling Lv 1 86 pts. 24,247
  4. Avatar for BootsMcGraw 4. BootsMcGraw Lv 1 80 pts. 24,182
  5. Avatar for ichwilldiesennamen 5. ichwilldiesennamen Lv 1 74 pts. 24,134
  6. Avatar for TheGUmmer 6. TheGUmmer Lv 1 68 pts. 23,898
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 63 pts. 23,896
  8. Avatar for Galaxie 8. Galaxie Lv 1 58 pts. 23,685
  9. Avatar for christioanchauvin 9. christioanchauvin Lv 1 53 pts. 23,661
  10. Avatar for gmn 10. gmn Lv 1 49 pts. 23,605

Comments