Icon representing a puzzle

2513: Revisiting Puzzle 73: Polycystein

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
September 25, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups

  1. Avatar for Eὕρηκα! Heureka! 11. Eὕρηκα! Heureka! 1 pt. 9,243
  2. Avatar for Extraterrestrials 2.0 12. Extraterrestrials 2.0 1 pt. 9,235
  3. Avatar for Beta Folders 13. Beta Folders 1 pt. 8,529
  4. Avatar for Rechenkraft.net 14. Rechenkraft.net 1 pt. 8,161
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,746
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 94 pts. 10,663
  3. Avatar for ichwilldiesennamen 3. ichwilldiesennamen Lv 1 87 pts. 10,661
  4. Avatar for gmn 4. gmn Lv 1 81 pts. 10,602
  5. Avatar for blazegeek 5. blazegeek Lv 1 75 pts. 10,575
  6. Avatar for TheGUmmer 6. TheGUmmer Lv 1 70 pts. 10,571
  7. Avatar for grogar7 7. grogar7 Lv 1 65 pts. 10,555
  8. Avatar for bravosk8erboy 8. bravosk8erboy Lv 1 60 pts. 10,547
  9. Avatar for akaaka 9. akaaka Lv 1 56 pts. 10,537
  10. Avatar for dcrwheeler 10. dcrwheeler Lv 1 51 pts. 10,487

Comments