Icon representing a puzzle

2513: Revisiting Puzzle 73: Polycystein

Closed since over 1 year ago

Novice Overall Prediction

Summary


Created
September 25, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This domain is a component of a large glycoprotein in humans that has been linked to autosomal dominant polycystic kidney disease. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ATLVGPHGPLASGQLAAFHIAAPLPVTATRWDFGDGSAEVDAAGPAASHRYVLPGRYHVTAVLALGAGSALLGTDVQVEA

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,746
  2. Avatar for Go Science 2. Go Science 68 pts. 10,677
  3. Avatar for Void Crushers 3. Void Crushers 44 pts. 10,571
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 27 pts. 10,484
  5. Avatar for Contenders 5. Contenders 16 pts. 10,481
  6. Avatar for Australia 6. Australia 9 pts. 10,429
  7. Avatar for Marvin's bunch 7. Marvin's bunch 5 pts. 10,371
  8. Avatar for VeFold 8. VeFold 3 pts. 10,101
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 9,966
  10. Avatar for Russian team 10. Russian team 1 pt. 9,599

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,746
  2. Avatar for Bruno Kestemont 2. Bruno Kestemont Lv 1 94 pts. 10,663
  3. Avatar for ichwilldiesennamen 3. ichwilldiesennamen Lv 1 87 pts. 10,661
  4. Avatar for gmn 4. gmn Lv 1 81 pts. 10,602
  5. Avatar for blazegeek 5. blazegeek Lv 1 75 pts. 10,575
  6. Avatar for TheGUmmer 6. TheGUmmer Lv 1 70 pts. 10,571
  7. Avatar for grogar7 7. grogar7 Lv 1 65 pts. 10,555
  8. Avatar for bravosk8erboy 8. bravosk8erboy Lv 1 60 pts. 10,547
  9. Avatar for akaaka 9. akaaka Lv 1 56 pts. 10,537
  10. Avatar for dcrwheeler 10. dcrwheeler Lv 1 51 pts. 10,487

Comments