Icon representing a puzzle

2516: Revisiting Puzzle 74: Platypus Venom

Closed since over 1 year ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
October 01, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups


  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 8,761
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 8,616
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 8,362
  4. Avatar for Extraterrestrials 2.0 14. Extraterrestrials 2.0 1 pt. 8,231

  1. Avatar for Punzi Baker 3 21. Punzi Baker 3 Lv 1 23 pts. 9,481
  2. Avatar for Bletchley Park 22. Bletchley Park Lv 1 21 pts. 9,462
  3. Avatar for toshiue 23. toshiue Lv 1 20 pts. 9,456
  4. Avatar for blazegeek 24. blazegeek Lv 1 18 pts. 9,448
  5. Avatar for orily1337 25. orily1337 Lv 1 16 pts. 9,363
  6. Avatar for latin krepin 26. latin krepin Lv 1 15 pts. 9,358
  7. Avatar for Hellcat6 27. Hellcat6 Lv 1 14 pts. 9,347
  8. Avatar for rosie4loop 28. rosie4loop Lv 1 12 pts. 9,343
  9. Avatar for heather-1 29. heather-1 Lv 1 11 pts. 9,322
  10. Avatar for alcor29 30. alcor29 Lv 1 10 pts. 9,269

Comments