Icon representing a puzzle

2516: Revisiting Puzzle 74: Platypus Venom

Closed since over 1 year ago

Novice Overall Prediction

Summary


Created
October 01, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups


  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 8,761
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 8,616
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 8,362
  4. Avatar for Extraterrestrials 2.0 14. Extraterrestrials 2.0 1 pt. 8,231

  1. Avatar for mnucer 41. mnucer Lv 1 3 pts. 9,012
  2. Avatar for Dr.Sillem 42. Dr.Sillem Lv 1 3 pts. 8,972
  3. Avatar for pfirth 43. pfirth Lv 1 3 pts. 8,970
  4. Avatar for JuliaBCollet 44. JuliaBCollet Lv 1 2 pts. 8,962
  5. Avatar for carxo 45. carxo Lv 1 2 pts. 8,805
  6. Avatar for AlphaFold2 46. AlphaFold2 Lv 1 2 pts. 8,766
  7. Avatar for dahast.de 47. dahast.de Lv 1 2 pts. 8,761
  8. Avatar for Gargamerluzzo 48. Gargamerluzzo Lv 1 1 pt. 8,752
  9. Avatar for Alistair69 49. Alistair69 Lv 1 1 pt. 8,657
  10. Avatar for Merf 50. Merf Lv 1 1 pt. 8,630

Comments