Icon representing a puzzle

2516: Revisiting Puzzle 74: Platypus Venom

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
October 01, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 8,761
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 8,616
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 8,362
  4. Avatar for Extraterrestrials 2.0 14. Extraterrestrials 2.0 1 pt. 8,231
  1. Avatar for Altercomp 51. Altercomp Lv 1 1 pt. 8,622
  2. Avatar for ShadowTactics 52. ShadowTactics Lv 1 1 pt. 8,616
  3. Avatar for DScott 53. DScott Lv 1 1 pt. 8,458
  4. Avatar for Trajan464 54. Trajan464 Lv 1 1 pt. 8,416
  5. Avatar for RealPerson 55. RealPerson Lv 1 1 pt. 8,362
  6. Avatar for hada 56. hada Lv 1 1 pt. 8,318
  7. Avatar for RWoodcock 57. RWoodcock Lv 1 1 pt. 8,317
  8. Avatar for turbolag 58. turbolag Lv 1 1 pt. 8,267
  9. Avatar for nancy_naniewoo 59. nancy_naniewoo Lv 1 1 pt. 8,239
  10. Avatar for rinze 60. rinze Lv 1 1 pt. 8,235

Comments