Icon representing a puzzle

2516: Revisiting Puzzle 74: Platypus Venom

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
October 01, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 8,761
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 8,616
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 8,362
  4. Avatar for Extraterrestrials 2.0 14. Extraterrestrials 2.0 1 pt. 8,231
  1. Avatar for zanbato 61. zanbato Lv 1 1 pt. 8,231
  2. Avatar for Mohoernchen 62. Mohoernchen Lv 1 1 pt. 8,181
  3. Avatar for zbp 63. zbp Lv 1 1 pt. 8,101
  4. Avatar for mart0258 64. mart0258 Lv 1 1 pt. 8,096
  5. Avatar for apetrides 65. apetrides Lv 1 1 pt. 8,083
  6. Avatar for Manika Gupta 66. Manika Gupta Lv 1 1 pt. 8,048
  7. Avatar for KRUK94 67. KRUK94 Lv 1 1 pt. 8,029
  8. Avatar for Sammy3c2b1a0 68. Sammy3c2b1a0 Lv 1 1 pt. 7,951
  9. Avatar for Swapper242 69. Swapper242 Lv 1 1 pt. 7,899
  10. Avatar for efull 70. efull Lv 1 1 pt. 7,893

Comments