Icon representing a puzzle

2516: Revisiting Puzzle 74: Platypus Venom

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
October 01, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups

  1. Avatar for SETI.Germany 11. SETI.Germany 1 pt. 8,761
  2. Avatar for BOINC@Poland 12. BOINC@Poland 1 pt. 8,616
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 8,362
  4. Avatar for Extraterrestrials 2.0 14. Extraterrestrials 2.0 1 pt. 8,231
  1. Avatar for vyndaquel 71. vyndaquel Lv 1 1 pt. 7,812
  2. Avatar for WuWTq 72. WuWTq Lv 1 1 pt. 7,745
  3. Avatar for oniiion 73. oniiion Lv 1 1 pt. 7,393
  4. Avatar for katharinewhite 74. katharinewhite Lv 1 1 pt. 7,270
  5. Avatar for Tehnologik1 75. Tehnologik1 Lv 1 1 pt. 6,945
  6. Avatar for equilibria 76. equilibria Lv 1 1 pt. 5,878
  7. Avatar for carolinegcampbell 77. carolinegcampbell Lv 1 1 pt. 5,878
  8. Avatar for nicolo.gennari 78. nicolo.gennari Lv 1 1 pt. 5,878
  9. Avatar for Arlind1 79. Arlind1 Lv 1 1 pt. 5,878

Comments