Icon representing a puzzle

2516: Revisiting Puzzle 74: Platypus Venom

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
October 01, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,743
  2. Avatar for Void Crushers 2. Void Crushers 68 pts. 9,742
  3. Avatar for Go Science 3. Go Science 44 pts. 9,728
  4. Avatar for VeFold 4. VeFold 27 pts. 9,683
  5. Avatar for Contenders 5. Contenders 16 pts. 9,604
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 9,594
  7. Avatar for Australia 7. Australia 5 pts. 9,562
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 3 pts. 9,547
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 9,546
  10. Avatar for Russian team 10. Russian team 1 pt. 9,104
  1. Avatar for BootsMcGraw 11. BootsMcGraw Lv 1 51 pts. 9,604
  2. Avatar for fpc 12. fpc Lv 1 47 pts. 9,594
  3. Avatar for drumpeter18yrs9yrs 13. drumpeter18yrs9yrs Lv 1 44 pts. 9,571
  4. Avatar for AlkiP0Ps 14. AlkiP0Ps Lv 1 41 pts. 9,562
  5. Avatar for christioanchauvin 15. christioanchauvin Lv 1 38 pts. 9,547
  6. Avatar for WBarme1234 16. WBarme1234 Lv 1 35 pts. 9,546
  7. Avatar for g_b 17. g_b Lv 1 32 pts. 9,538
  8. Avatar for hookedwarm 18. hookedwarm Lv 1 30 pts. 9,510
  9. Avatar for Bruno Kestemont 19. Bruno Kestemont Lv 1 27 pts. 9,498
  10. Avatar for Galaxie 20. Galaxie Lv 1 25 pts. 9,493

Comments