Icon representing a puzzle

2516: Revisiting Puzzle 74: Platypus Venom

Closed since over 1 year ago

Novice Overall Prediction

Summary


Created
October 01, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small peptide was discovered in platypus venom-a rare instance of mammalian-produced venom, although this peptide appears similar to more widespread antimicrobials. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
FVQHRPRDCESINGVCRHKDTVNCREIFLADCYNDGQKCCRK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,743
  2. Avatar for Void Crushers 2. Void Crushers 68 pts. 9,742
  3. Avatar for Go Science 3. Go Science 44 pts. 9,728
  4. Avatar for VeFold 4. VeFold 27 pts. 9,683
  5. Avatar for Contenders 5. Contenders 16 pts. 9,604
  6. Avatar for Marvin's bunch 6. Marvin's bunch 9 pts. 9,594
  7. Avatar for Australia 7. Australia 5 pts. 9,562
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 3 pts. 9,547
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 9,546
  10. Avatar for Russian team 10. Russian team 1 pt. 9,104

  1. Avatar for Crossed Sticks 31. Crossed Sticks Lv 1 9 pts. 9,262
  2. Avatar for Idiotboy 32. Idiotboy Lv 1 8 pts. 9,240
  3. Avatar for maithra 33. maithra Lv 1 8 pts. 9,199
  4. Avatar for roarshock 34. roarshock Lv 1 7 pts. 9,190
  5. Avatar for pizpot 35. pizpot Lv 1 6 pts. 9,164
  6. Avatar for ProfVince 37. ProfVince Lv 1 5 pts. 9,137
  7. Avatar for Gerom 38. Gerom Lv 1 5 pts. 9,104
  8. Avatar for Kiwegapa 39. Kiwegapa Lv 1 4 pts. 9,072
  9. Avatar for Th1sN@me!sN0tAPun 40. Th1sN@me!sN0tAPun Lv 1 4 pts. 9,015

Comments