Placeholder image of a protein
Icon representing a puzzle

2520: Refine Density Reconstruction 9

Closed since over 1 year ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density

Summary


Created
October 03, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2326, which was Reconstruction Puzzle 48, but now we have the Refine Density tool available to make folds even better! This puzzle has four chains in it, two of each type. Two have the sequence GIVEQCCTSICSLYQLENYCN and two have the sequence FVNQHLCGEHLVEALYLVCGERGFFYTPKT.

Top groups


  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 14,751
  2. Avatar for Rechenkraft.net 12. Rechenkraft.net 1 pt. 13,739

  1. Avatar for gmn
    1. gmn Lv 1
    100 pts. 15,793
  2. Avatar for ichwilldiesennamen 2. ichwilldiesennamen Lv 1 93 pts. 15,765
  3. Avatar for LociOiling 3. LociOiling Lv 1 87 pts. 15,736
  4. Avatar for TheGUmmer 4. TheGUmmer Lv 1 81 pts. 15,694
  5. Avatar for bravosk8erboy 5. bravosk8erboy Lv 1 75 pts. 15,661
  6. Avatar for christioanchauvin 6. christioanchauvin Lv 1 69 pts. 15,652
  7. Avatar for latin krepin 7. latin krepin Lv 1 64 pts. 15,591
  8. Avatar for Bletchley Park 8. Bletchley Park Lv 1 59 pts. 15,449
  9. Avatar for Punzi Baker 3 9. Punzi Baker 3 Lv 1 55 pts. 15,421
  10. Avatar for blazegeek 10. blazegeek Lv 1 50 pts. 15,342

Comments