2520: Refine Density Reconstruction 9
Closed since over 1 year ago
Novice Overall Prediction Electron DensitySummary
- Created
- October 03, 2024
- Expires
- Max points
- 100
This is a protein we've given before in puzzle 2326, which was Reconstruction Puzzle 48, but now we have the Refine Density tool available to make folds even better! This puzzle has four chains in it, two of each type. Two have the sequence GIVEQCCTSICSLYQLENYCN and two have the sequence FVNQHLCGEHLVEALYLVCGERGFFYTPKT.