Placeholder image of a protein
Icon representing a puzzle

2520: Refine Density Reconstruction 9

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary


Created
October 03, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2326, which was Reconstruction Puzzle 48, but now we have the Refine Density tool available to make folds even better! This puzzle has four chains in it, two of each type. Two have the sequence GIVEQCCTSICSLYQLENYCN and two have the sequence FVNQHLCGEHLVEALYLVCGERGFFYTPKT.

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 15,801
  2. Avatar for Go Science 2. Go Science 63 pts. 15,784
  3. Avatar for Void Crushers 3. Void Crushers 37 pts. 15,694
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 15,652
  5. Avatar for Contenders 5. Contenders 11 pts. 15,449
  6. Avatar for Marvin's bunch 6. Marvin's bunch 5 pts. 15,130
  7. Avatar for Australia 7. Australia 2 pts. 15,113
  8. Avatar for Extraterrestrials 2.0 8. Extraterrestrials 2.0 1 pt. 15,018
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 15,000
  10. Avatar for VeFold 10. VeFold 1 pt. 14,902

  1. Avatar for gmn
    1. gmn Lv 1
    100 pts. 15,793
  2. Avatar for ichwilldiesennamen 2. ichwilldiesennamen Lv 1 93 pts. 15,765
  3. Avatar for LociOiling 3. LociOiling Lv 1 87 pts. 15,736
  4. Avatar for TheGUmmer 4. TheGUmmer Lv 1 81 pts. 15,694
  5. Avatar for bravosk8erboy 5. bravosk8erboy Lv 1 75 pts. 15,661
  6. Avatar for christioanchauvin 6. christioanchauvin Lv 1 69 pts. 15,652
  7. Avatar for latin krepin 7. latin krepin Lv 1 64 pts. 15,591
  8. Avatar for Bletchley Park 8. Bletchley Park Lv 1 59 pts. 15,449
  9. Avatar for Punzi Baker 3 9. Punzi Baker 3 Lv 1 55 pts. 15,421
  10. Avatar for blazegeek 10. blazegeek Lv 1 50 pts. 15,342

Comments