Placeholder image of a protein
Icon representing a puzzle

2520: Refine Density Reconstruction 9

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
October 03, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2326, which was Reconstruction Puzzle 48, but now we have the Refine Density tool available to make folds even better! This puzzle has four chains in it, two of each type. Two have the sequence GIVEQCCTSICSLYQLENYCN and two have the sequence FVNQHLCGEHLVEALYLVCGERGFFYTPKT.

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 15,801
  2. Avatar for Go Science 2. Go Science 63 pts. 15,784
  3. Avatar for Void Crushers 3. Void Crushers 37 pts. 15,694
  4. Avatar for L'Alliance Francophone 4. L'Alliance Francophone 21 pts. 15,652
  5. Avatar for Contenders 5. Contenders 11 pts. 15,449
  6. Avatar for Marvin's bunch 6. Marvin's bunch 5 pts. 15,130
  7. Avatar for Australia 7. Australia 2 pts. 15,113
  8. Avatar for Extraterrestrials 2.0 8. Extraterrestrials 2.0 1 pt. 15,018
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 15,000
  10. Avatar for VeFold 10. VeFold 1 pt. 14,902
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 15,801
  2. Avatar for Galaxie 2. Galaxie Lv 1 52 pts. 15,799
  3. Avatar for gmn 3. gmn Lv 1 24 pts. 15,793
  4. Avatar for Bruno Kestemont 4. Bruno Kestemont Lv 1 10 pts. 15,784
  5. Avatar for toshiue 5. toshiue Lv 1 4 pts. 15,772
  6. Avatar for bravosk8erboy 6. bravosk8erboy Lv 1 1 pt. 15,765
  7. Avatar for alcor29 7. alcor29 Lv 1 1 pt. 15,395
  8. Avatar for Bletchley Park 8. Bletchley Park Lv 1 1 pt. 15,194
  9. Avatar for Steven Pletsch 9. Steven Pletsch Lv 1 1 pt. 15,062

Comments