Icon representing a puzzle

2519: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary


Created
October 09, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups


  1. Avatar for Team China 11. Team China 1 pt. 9,819
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 9,750
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 9,140

  1. Avatar for akaaka 11. akaaka Lv 1 54 pts. 10,090
  2. Avatar for orily1337 12. orily1337 Lv 1 51 pts. 10,080
  3. Avatar for WBarme1234 13. WBarme1234 Lv 1 47 pts. 10,055
  4. Avatar for drumpeter18yrs9yrs 14. drumpeter18yrs9yrs Lv 1 44 pts. 10,049
  5. Avatar for grogar7 15. grogar7 Lv 1 41 pts. 10,047
  6. Avatar for fpc 16. fpc Lv 1 38 pts. 10,042
  7. Avatar for AlkiP0Ps 17. AlkiP0Ps Lv 1 36 pts. 10,031
  8. Avatar for g_b 18. g_b Lv 1 33 pts. 10,030
  9. Avatar for Galaxie 19. Galaxie Lv 1 31 pts. 10,030
  10. Avatar for TheGUmmer 20. TheGUmmer Lv 1 29 pts. 10,026

Comments