Icon representing a puzzle

2519: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
October 09, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Team China 11. Team China 1 pt. 9,819
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 9,750
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 9,140
  1. Avatar for Crossed Sticks 21. Crossed Sticks Lv 1 27 pts. 10,024
  2. Avatar for Punzi Baker 3 22. Punzi Baker 3 Lv 1 25 pts. 10,015
  3. Avatar for dcrwheeler 23. dcrwheeler Lv 1 23 pts. 10,004
  4. Avatar for alcor29 24. alcor29 Lv 1 21 pts. 9,992
  5. Avatar for Bletchley Park 25. Bletchley Park Lv 1 20 pts. 9,980
  6. Avatar for Alistair69 26. Alistair69 Lv 1 18 pts. 9,975
  7. Avatar for The Cleric 27. The Cleric Lv 1 17 pts. 9,970
  8. Avatar for JuliaBCollet 28. JuliaBCollet Lv 1 15 pts. 9,970
  9. Avatar for BarrySampson 29. BarrySampson Lv 1 14 pts. 9,963
  10. Avatar for roarshock 30. roarshock Lv 1 13 pts. 9,955

Comments