Icon representing a puzzle

2519: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
October 09, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Team China 11. Team China 1 pt. 9,819
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 9,750
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 9,140
  1. Avatar for pfirth 51. pfirth Lv 1 2 pts. 9,732
  2. Avatar for rosie4loop 52. rosie4loop Lv 1 2 pts. 9,725
  3. Avatar for AlphaFold2 53. AlphaFold2 Lv 1 1 pt. 9,715
  4. Avatar for nicobul 54. nicobul Lv 1 1 pt. 9,688
  5. Avatar for ProfVince 55. ProfVince Lv 1 1 pt. 9,631
  6. Avatar for wosser1 56. wosser1 Lv 1 1 pt. 9,630
  7. Avatar for apetrides 57. apetrides Lv 1 1 pt. 9,611
  8. Avatar for Merf 58. Merf Lv 1 1 pt. 9,603
  9. Avatar for nancy_naniewoo 59. nancy_naniewoo Lv 1 1 pt. 9,583
  10. Avatar for meatexplosion 60. meatexplosion Lv 1 1 pt. 9,571

Comments