Icon representing a puzzle

2519: Revisiting Puzzle 75: Antifreeze Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
October 09, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This eelpout protein binds nucleated ice crystals to inhibit their growth. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
ANQASVVANQLIPINTALTLVMMRSEVVTPVGIPAEDIPRLVSMQVNRAVPLGTTLMPDMVRGYAA

Top groups

  1. Avatar for Team China 11. Team China 1 pt. 9,819
  2. Avatar for Trinity Biology 12. Trinity Biology 1 pt. 9,750
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 9,140
  1. Avatar for Swapper242 81. Swapper242 Lv 1 1 pt. 8,476
  2. Avatar for bibibon 82. bibibon Lv 1 1 pt. 7,744
  3. Avatar for plextoo 83. plextoo Lv 1 1 pt. 5,132
  4. Avatar for STT 84. STT Lv 1 1 pt. 5,049
  5. Avatar for LilyLLPhD 85. LilyLLPhD Lv 1 1 pt. 0
  6. Avatar for toshiue 86. toshiue Lv 1 1 pt. 0

Comments