Placeholder image of a protein
Icon representing a puzzle

2523: Refine Density Reconstruction 10

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
October 16, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2374, which was Reconstruction Puzzle 64, but now we have the Refine Density tool available to make folds even better!There are two chains in this puzzle of the same sequence, but not all the segments are visible in the density.

Sequence
MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKDGEVKPWPS

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 18,695
  2. Avatar for I-14 Salt Bridges 12. I-14 Salt Bridges 1 pt. 18,589
  3. Avatar for Czech National Team 13. Czech National Team 1 pt. 18,566
  1. Avatar for bravosk8erboy
    1. bravosk8erboy Lv 1
    100 pts. 20,115
  2. Avatar for ichwilldiesennamen 2. ichwilldiesennamen Lv 1 93 pts. 19,885
  3. Avatar for christioanchauvin 3. christioanchauvin Lv 1 87 pts. 19,668
  4. Avatar for Bletchley Park 4. Bletchley Park Lv 1 81 pts. 19,621
  5. Avatar for blazegeek 5. blazegeek Lv 1 75 pts. 19,592
  6. Avatar for BootsMcGraw 6. BootsMcGraw Lv 1 69 pts. 19,574
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 64 pts. 19,565
  8. Avatar for toshiue 8. toshiue Lv 1 59 pts. 19,552
  9. Avatar for Punzi Baker 3 9. Punzi Baker 3 Lv 1 55 pts. 19,551
  10. Avatar for LociOiling 10. LociOiling Lv 1 50 pts. 19,519

Comments