Placeholder image of a protein
Icon representing a puzzle

2523: Refine Density Reconstruction 10

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary

Created
October 16, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2374, which was Reconstruction Puzzle 64, but now we have the Refine Density tool available to make folds even better!There are two chains in this puzzle of the same sequence, but not all the segments are visible in the density.

Sequence
MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKDGEVKPWPS

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 20,136
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 65 pts. 19,668
  3. Avatar for Contenders 3. Contenders 41 pts. 19,621
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 24 pts. 19,522
  5. Avatar for Void Crushers 5. Void Crushers 14 pts. 19,374
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 7 pts. 19,306
  7. Avatar for Australia 7. Australia 4 pts. 19,302
  8. Avatar for VeFold 8. VeFold 2 pts. 19,300
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 19,115
  10. Avatar for Extraterrestrials 2.0 10. Extraterrestrials 2.0 1 pt. 18,853
  1. Avatar for bravosk8erboy
    1. bravosk8erboy Lv 1
    100 pts. 20,115
  2. Avatar for ichwilldiesennamen 2. ichwilldiesennamen Lv 1 93 pts. 19,885
  3. Avatar for christioanchauvin 3. christioanchauvin Lv 1 87 pts. 19,668
  4. Avatar for Bletchley Park 4. Bletchley Park Lv 1 81 pts. 19,621
  5. Avatar for blazegeek 5. blazegeek Lv 1 75 pts. 19,592
  6. Avatar for BootsMcGraw 6. BootsMcGraw Lv 1 69 pts. 19,574
  7. Avatar for Bruno Kestemont 7. Bruno Kestemont Lv 1 64 pts. 19,565
  8. Avatar for toshiue 8. toshiue Lv 1 59 pts. 19,552
  9. Avatar for Punzi Baker 3 9. Punzi Baker 3 Lv 1 55 pts. 19,551
  10. Avatar for LociOiling 10. LociOiling Lv 1 50 pts. 19,519

Comments