2523: Refine Density Reconstruction 10
Closed since over 1 year ago
Novice Novice Overall Overall Prediction Prediction Electron Density Electron DensitySummary
- Created
- October 16, 2024
- Expires
- Max points
- 100
This is a protein we've given before in puzzle 2374, which was Reconstruction Puzzle 64, but now we have the Refine Density tool available to make folds even better!There are two chains in this puzzle of the same sequence, but not all the segments are visible in the density.
- Sequence
- MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKDGEVKPWPS