Placeholder image of a protein
Icon representing a puzzle

2523: Refine Density Reconstruction 10

Closed since over 1 year ago

Novice Overall Prediction Electron Density

Summary


Created
October 16, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2374, which was Reconstruction Puzzle 64, but now we have the Refine Density tool available to make folds even better!There are two chains in this puzzle of the same sequence, but not all the segments are visible in the density.

Sequence
MEQRITLKDYAMRFGQTKTAKDLGVYQSAINKAIHAGRKIFLTINADGSVYAEEVKDGEVKPWPS

Top groups


  1. Avatar for Go Science 100 pts. 20,136
  2. Avatar for L'Alliance Francophone 2. L'Alliance Francophone 65 pts. 19,668
  3. Avatar for Contenders 3. Contenders 41 pts. 19,621
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 24 pts. 19,522
  5. Avatar for Void Crushers 5. Void Crushers 14 pts. 19,374
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 7 pts. 19,306
  7. Avatar for Australia 7. Australia 4 pts. 19,302
  8. Avatar for VeFold 8. VeFold 2 pts. 19,300
  9. Avatar for Marvin's bunch 9. Marvin's bunch 1 pt. 19,115
  10. Avatar for Extraterrestrials 2.0 10. Extraterrestrials 2.0 1 pt. 18,853

  1. Avatar for futsall 61. futsall Lv 1 1 pt. 17,835
  2. Avatar for pro_stealth 62. pro_stealth Lv 1 1 pt. 17,832
  3. Avatar for Swapper242 63. Swapper242 Lv 1 1 pt. 17,807
  4. Avatar for furi0us 64. furi0us Lv 1 1 pt. 17,756
  5. Avatar for ivalnic 65. ivalnic Lv 1 1 pt. 14,617
  6. Avatar for PhilKania 66. PhilKania Lv 1 1 pt. 14,153
  7. Avatar for Tea_Cheurte 67. Tea_Cheurte Lv 1 1 pt. 14,150
  8. Avatar for beta_helix 68. beta_helix Lv 1 1 pt. 14,150
  9. Avatar for Tenlocket 69. Tenlocket Lv 1 1 pt. 14,150
  10. Avatar for danil1247 70. danil1247 Lv 1 1 pt. 14,150

Comments