Icon representing a puzzle

2525: Revisiting Puzzle 77: Copper Chaperone

Closed since over 1 year ago

Novice Overall Prediction

Summary


Created
October 23, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups


  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 9,370
  2. Avatar for Extraterrestrials 2.0 12. Extraterrestrials 2.0 1 pt. 9,316
  3. Avatar for Rechenkraft.net 13. Rechenkraft.net 1 pt. 8,498
  4. Avatar for Czech National Team 14. Czech National Team 1 pt. 8,257

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,388
  2. Avatar for ichwilldiesennamen 2. ichwilldiesennamen Lv 1 95 pts. 10,225
  3. Avatar for dcrwheeler 3. dcrwheeler Lv 1 89 pts. 10,222
  4. Avatar for orily1337 4. orily1337 Lv 1 84 pts. 10,178
  5. Avatar for bravosk8erboy 5. bravosk8erboy Lv 1 79 pts. 10,098
  6. Avatar for blazegeek 6. blazegeek Lv 1 75 pts. 10,080
  7. Avatar for Galaxie 7. Galaxie Lv 1 70 pts. 10,066
  8. Avatar for AlkiP0Ps 8. AlkiP0Ps Lv 1 66 pts. 10,049
  9. Avatar for Bruno Kestemont 9. Bruno Kestemont Lv 1 62 pts. 10,046
  10. Avatar for BootsMcGraw 10. BootsMcGraw Lv 1 58 pts. 10,021

Comments