Icon representing a puzzle

2525: Revisiting Puzzle 77: Copper Chaperone

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
October 23, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,388
  2. Avatar for Go Science 2. Go Science 68 pts. 10,241
  3. Avatar for Marvin's bunch 3. Marvin's bunch 44 pts. 10,178
  4. Avatar for Australia 4. Australia 27 pts. 10,049
  5. Avatar for Contenders 5. Contenders 16 pts. 10,021
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 9,926
  7. Avatar for Void Crushers 7. Void Crushers 5 pts. 9,859
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 3 pts. 9,703
  9. Avatar for VeFold 9. VeFold 1 pt. 9,656
  10. Avatar for I-14 Salt Bridges 10. I-14 Salt Bridges 1 pt. 9,648
  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,388
  2. Avatar for ichwilldiesennamen 2. ichwilldiesennamen Lv 1 95 pts. 10,225
  3. Avatar for dcrwheeler 3. dcrwheeler Lv 1 89 pts. 10,222
  4. Avatar for orily1337 4. orily1337 Lv 1 84 pts. 10,178
  5. Avatar for bravosk8erboy 5. bravosk8erboy Lv 1 79 pts. 10,098
  6. Avatar for blazegeek 6. blazegeek Lv 1 75 pts. 10,080
  7. Avatar for Galaxie 7. Galaxie Lv 1 70 pts. 10,066
  8. Avatar for AlkiP0Ps 8. AlkiP0Ps Lv 1 66 pts. 10,049
  9. Avatar for Bruno Kestemont 9. Bruno Kestemont Lv 1 62 pts. 10,046
  10. Avatar for BootsMcGraw 10. BootsMcGraw Lv 1 58 pts. 10,021

Comments