Icon representing a puzzle

2525: Revisiting Puzzle 77: Copper Chaperone

Closed since over 1 year ago

Novice Overall Prediction

Summary


Created
October 23, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein binds copper ions so that they may be transported safely to the cell compartments and enzymes that require them. The protein is modeled here in the reduced state, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
AQEFSVKGMSCNHCVARIEEAVGRISGVKKVKVQLKKEKAVVKFDEANVQATEICQAINELGYQAEVI

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,388
  2. Avatar for Go Science 2. Go Science 68 pts. 10,241
  3. Avatar for Marvin's bunch 3. Marvin's bunch 44 pts. 10,178
  4. Avatar for Australia 4. Australia 27 pts. 10,049
  5. Avatar for Contenders 5. Contenders 16 pts. 10,021
  6. Avatar for FamilyBarmettler 6. FamilyBarmettler 9 pts. 9,926
  7. Avatar for Void Crushers 7. Void Crushers 5 pts. 9,859
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 3 pts. 9,703
  9. Avatar for VeFold 9. VeFold 1 pt. 9,656
  10. Avatar for I-14 Salt Bridges 10. I-14 Salt Bridges 1 pt. 9,648

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,387
  2. Avatar for Galaxie 2. Galaxie Lv 1 41 pts. 10,387
  3. Avatar for gmn 3. gmn Lv 1 14 pts. 10,369
  4. Avatar for meatexplosion 4. meatexplosion Lv 1 4 pts. 10,368
  5. Avatar for alcor29 5. alcor29 Lv 1 1 pt. 10,362
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 1 pt. 10,241
  7. Avatar for Bletchley Park 7. Bletchley Park Lv 1 1 pt. 9,671

Comments