Icon representing a puzzle

2531: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
November 06, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 9,607
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 8,794
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,468
  4. Avatar for Coastal Biochemistry 14. Coastal Biochemistry 1 pt. 7,976
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 7,660
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 3,334
  1. Avatar for g_b 11. g_b Lv 1 54 pts. 9,950
  2. Avatar for akaaka 12. akaaka Lv 1 51 pts. 9,941
  3. Avatar for hookedwarm 13. hookedwarm Lv 1 47 pts. 9,940
  4. Avatar for orily1337 14. orily1337 Lv 1 44 pts. 9,938
  5. Avatar for AlkiP0Ps 15. AlkiP0Ps Lv 1 41 pts. 9,929
  6. Avatar for Aubade01 16. Aubade01 Lv 1 38 pts. 9,928
  7. Avatar for TheGUmmer 17. TheGUmmer Lv 1 36 pts. 9,926
  8. Avatar for EmelendezTAMUCT 18. EmelendezTAMUCT Lv 1 33 pts. 9,921
  9. Avatar for christioanchauvin 19. christioanchauvin Lv 1 31 pts. 9,917
  10. Avatar for Punzi Baker 3 20. Punzi Baker 3 Lv 1 29 pts. 9,904

Comments