Icon representing a puzzle

2531: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
November 06, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 9,607
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 8,794
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,468
  4. Avatar for Coastal Biochemistry 14. Coastal Biochemistry 1 pt. 7,976
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 7,660
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 3,334
  1. Avatar for BootsMcGraw 21. BootsMcGraw Lv 1 27 pts. 9,889
  2. Avatar for WBarme1234 22. WBarme1234 Lv 1 25 pts. 9,885
  3. Avatar for blazegeek 23. blazegeek Lv 1 23 pts. 9,879
  4. Avatar for alcor29 24. alcor29 Lv 1 21 pts. 9,877
  5. Avatar for BarrySampson 25. BarrySampson Lv 1 20 pts. 9,802
  6. Avatar for dcrwheeler 26. dcrwheeler Lv 1 18 pts. 9,744
  7. Avatar for Crossed Sticks 27. Crossed Sticks Lv 1 17 pts. 9,724
  8. Avatar for Anfinsen_slept_here 28. Anfinsen_slept_here Lv 1 15 pts. 9,716
  9. Avatar for SemperRabbit 29. SemperRabbit Lv 1 14 pts. 9,700
  10. Avatar for manu8170 30. manu8170 Lv 1 13 pts. 9,646

Comments