Icon representing a puzzle

2531: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
November 06, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 9,607
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 8,794
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,468
  4. Avatar for Coastal Biochemistry 14. Coastal Biochemistry 1 pt. 7,976
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 7,660
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 3,334
  1. Avatar for JuliaBCollet 31. JuliaBCollet Lv 1 12 pts. 9,632
  2. Avatar for drumpeter18yrs9yrs 32. drumpeter18yrs9yrs Lv 1 11 pts. 9,624
  3. Avatar for Gerom 33. Gerom Lv 1 10 pts. 9,607
  4. Avatar for carsonfb 34. carsonfb Lv 1 9 pts. 9,604
  5. Avatar for roarshock 35. roarshock Lv 1 8 pts. 9,604
  6. Avatar for meatexplosion 36. meatexplosion Lv 1 8 pts. 9,599
  7. Avatar for Vinara 37. Vinara Lv 1 7 pts. 9,581
  8. Avatar for pfirth 38. pfirth Lv 1 6 pts. 9,475
  9. Avatar for rosie4loop 39. rosie4loop Lv 1 6 pts. 9,455
  10. Avatar for heather-1 40. heather-1 Lv 1 5 pts. 9,446

Comments