Icon representing a puzzle

2531: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
November 06, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 9,607
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 8,794
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,468
  4. Avatar for Coastal Biochemistry 14. Coastal Biochemistry 1 pt. 7,976
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 7,660
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 3,334
  1. Avatar for Th1sN@me!sN0tAPun 41. Th1sN@me!sN0tAPun Lv 1 5 pts. 9,345
  2. Avatar for lancetime 42. lancetime Lv 1 4 pts. 9,248
  3. Avatar for toshiue 43. toshiue Lv 1 4 pts. 9,196
  4. Avatar for NPrincipi 44. NPrincipi Lv 1 3 pts. 9,143
  5. Avatar for Larini 45. Larini Lv 1 3 pts. 9,105
  6. Avatar for DScott 46. DScott Lv 1 3 pts. 9,071
  7. Avatar for Dr.Sillem 47. Dr.Sillem Lv 1 3 pts. 9,070
  8. Avatar for Hellcat6 48. Hellcat6 Lv 1 2 pts. 9,021
  9. Avatar for hada 49. hada Lv 1 2 pts. 9,016
  10. Avatar for sitlux 50. sitlux Lv 1 2 pts. 9,009

Comments