Icon representing a puzzle

2531: Revisiting Puzzle 80: Calcium Channel Blocker

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
November 06, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is found in green mamba venom, and blocks the flow of calcium ions that normally depolarize the muscle cell to induce muscle contraction. This protein contains six cysteine residues that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
WQPPWYCKEPVRIGSCKKQFSSFYFKWTAKKCLPFLFSGCGGNANRFQTIGECRKKCLGK

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 9,607
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 8,794
  3. Avatar for Trinity Biology 13. Trinity Biology 1 pt. 8,468
  4. Avatar for Coastal Biochemistry 14. Coastal Biochemistry 1 pt. 7,976
  5. Avatar for Rechenkraft.net 15. Rechenkraft.net 1 pt. 7,660
  6. Avatar for Foldit Staff 16. Foldit Staff 1 pt. 3,334
  1. Avatar for Swapper242 81. Swapper242 Lv 1 1 pt. 7,730
  2. Avatar for Kajjames02 82. Kajjames02 Lv 1 1 pt. 7,716
  3. Avatar for furi0us 83. furi0us Lv 1 1 pt. 7,685
  4. Avatar for lyricalcarpenter 84. lyricalcarpenter Lv 1 1 pt. 7,680
  5. Avatar for Sammy3c2b1a0 85. Sammy3c2b1a0 Lv 1 1 pt. 7,660
  6. Avatar for Sciren 86. Sciren Lv 1 1 pt. 3,334

Comments