Icon representing a puzzle

2534: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
November 13, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 9,889
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 9,789
  3. Avatar for Androids 13. Androids 1 pt. 9,276
  1. Avatar for WBarme1234 21. WBarme1234 Lv 1 28 pts. 10,325
  2. Avatar for JuliaBCollet 22. JuliaBCollet Lv 1 26 pts. 10,301
  3. Avatar for NPrincipi 23. NPrincipi Lv 1 24 pts. 10,286
  4. Avatar for Anfinsen_slept_here 24. Anfinsen_slept_here Lv 1 22 pts. 10,283
  5. Avatar for Dr.Sillem 25. Dr.Sillem Lv 1 20 pts. 10,259
  6. Avatar for pfirth 26. pfirth Lv 1 19 pts. 10,253
  7. Avatar for hookedwarm 27. hookedwarm Lv 1 17 pts. 10,244
  8. Avatar for alcor29 28. alcor29 Lv 1 16 pts. 10,243
  9. Avatar for rosie4loop 29. rosie4loop Lv 1 15 pts. 10,222
  10. Avatar for Kiwegapa 30. Kiwegapa Lv 1 14 pts. 10,207

Comments