Icon representing a puzzle

2534: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
November 13, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 9,889
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 9,789
  3. Avatar for Androids 13. Androids 1 pt. 9,276
  1. Avatar for drumpeter18yrs9yrs 41. drumpeter18yrs9yrs Lv 1 5 pts. 10,051
  2. Avatar for zbp 42. zbp Lv 1 5 pts. 10,040
  3. Avatar for Vinara 43. Vinara Lv 1 4 pts. 10,015
  4. Avatar for Mohoernchen 44. Mohoernchen Lv 1 4 pts. 10,014
  5. Avatar for GaryForbis 45. GaryForbis Lv 1 3 pts. 10,014
  6. Avatar for lancetime 46. lancetime Lv 1 3 pts. 10,001
  7. Avatar for hada 47. hada Lv 1 3 pts. 9,998
  8. Avatar for nancy_naniewoo 48. nancy_naniewoo Lv 1 3 pts. 9,997
  9. Avatar for alyssa_d_V2.0 49. alyssa_d_V2.0 Lv 1 2 pts. 9,889
  10. Avatar for abiogenesis 50. abiogenesis Lv 1 2 pts. 9,878

Comments