Icon representing a puzzle

2534: Revisiting Puzzle 81: Calcium Ion Binding Protein

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
November 13, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein, which inhibits muscle contraction in the absence of calcium ions, changes conformation in the presence of calcium to allow muscle contraction. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
QAEARAFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for Trinity Biology 11. Trinity Biology 1 pt. 9,889
  2. Avatar for SETI.Germany 12. SETI.Germany 1 pt. 9,789
  3. Avatar for Androids 13. Androids 1 pt. 9,276
  1. Avatar for Th1sN@me!sN0tAPun 61. Th1sN@me!sN0tAPun Lv 1 1 pt. 9,629
  2. Avatar for DuuaR 62. DuuaR Lv 1 1 pt. 9,470
  3. Avatar for rinze 63. rinze Lv 1 1 pt. 9,456
  4. Avatar for Merf 64. Merf Lv 1 1 pt. 9,426
  5. Avatar for kimmf 65. kimmf Lv 1 1 pt. 9,367
  6. Avatar for dm135 66. dm135 Lv 1 1 pt. 9,338
  7. Avatar for Cain2317 67. Cain2317 Lv 1 1 pt. 9,302
  8. Avatar for futsall 68. futsall Lv 1 1 pt. 9,282
  9. Avatar for heithar 69. heithar Lv 1 1 pt. 9,279
  10. Avatar for wudooAI 70. wudooAI Lv 1 1 pt. 9,276

Comments