Placeholder image of a protein
Icon representing a puzzle

2538: Refine Density Reconstruction 15

Closed since over 1 year ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Pilot Pilot Pilot Pilot Pilot Pilot

Summary


Created
November 14, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2234, which was Reconstruction Puzzle 18, but now we have the Refine Density tool available to make folds even better!

Sequence
GFEKYWFCYGIKCYYFDMDRKTWSGCKQTCQISSLSLLKIDNEDELKFLQNLAPSDISWIGFSYDNKKKDWAWIDNGPSKLALNTTKYNIRDGLCMSLSKTRLDNGDCGKSYICICGKRLDKFPH

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 28,323
  2. Avatar for Contenders 2. Contenders 56 pts. 27,700
  3. Avatar for Go Science 3. Go Science 29 pts. 27,470
  4. Avatar for VeFold 4. VeFold 14 pts. 27,176
  5. Avatar for Marvin's bunch 5. Marvin's bunch 6 pts. 26,935
  6. Avatar for Void Crushers 6. Void Crushers 2 pts. 26,823
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 1 pt. 26,814
  8. Avatar for Australia 8. Australia 1 pt. 26,465
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 26,319
  10. Avatar for Trinity Biology 10. Trinity Biology 1 pt. 23,516

  1. Avatar for gmn
    1. gmn Lv 1
    100 pts. 28,323
  2. Avatar for Galaxie 2. Galaxie Lv 1 47 pts. 28,269
  3. Avatar for meatexplosion 3. meatexplosion Lv 1 19 pts. 28,200
  4. Avatar for LociOiling 4. LociOiling Lv 1 7 pts. 28,186
  5. Avatar for alcor29 5. alcor29 Lv 1 2 pts. 28,019
  6. Avatar for Bruno Kestemont 6. Bruno Kestemont Lv 1 1 pt. 27,227
  7. Avatar for jamiexq 7. jamiexq Lv 1 1 pt. 26,162

Comments