2538: Refine Density Reconstruction 15
Closed since over 1 year ago
Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Pilot Pilot Pilot Pilot Pilot PilotSummary
- Created
- November 14, 2024
- Expires
- Max points
- 100
This is a protein we've given before in puzzle 2234, which was Reconstruction Puzzle 18, but now we have the Refine Density tool available to make folds even better!
- Sequence
- GFEKYWFCYGIKCYYFDMDRKTWSGCKQTCQISSLSLLKIDNEDELKFLQNLAPSDISWIGFSYDNKKKDWAWIDNGPSKLALNTTKYNIRDGLCMSLSKTRLDNGDCGKSYICICGKRLDKFPH