2538: Refine Density Reconstruction 15
Closed since over 1 year ago
Novice Overall Electron Density PilotSummary
- Created
- November 14, 2024
- Expires
- Max points
- 100
This is a protein we've given before in puzzle 2234, which was Reconstruction Puzzle 18, but now we have the Refine Density tool available to make folds even better!
- Sequence
- GFEKYWFCYGIKCYYFDMDRKTWSGCKQTCQISSLSLLKIDNEDELKFLQNLAPSDISWIGFSYDNKKKDWAWIDNGPSKLALNTTKYNIRDGLCMSLSKTRLDNGDCGKSYICICGKRLDKFPH