Placeholder image of a protein
Icon representing a puzzle

2538: Refine Density Reconstruction 15

Closed since over 1 year ago

Novice Novice Novice Novice Novice Novice Overall Overall Overall Overall Overall Overall Electron Density Electron Density Electron Density Electron Density Electron Density Electron Density Pilot Pilot Pilot Pilot Pilot Pilot

Summary


Created
November 14, 2024
Expires
Max points
100
Description

This is a protein we've given before in puzzle 2234, which was Reconstruction Puzzle 18, but now we have the Refine Density tool available to make folds even better!

Sequence
GFEKYWFCYGIKCYYFDMDRKTWSGCKQTCQISSLSLLKIDNEDELKFLQNLAPSDISWIGFSYDNKKKDWAWIDNGPSKLALNTTKYNIRDGLCMSLSKTRLDNGDCGKSYICICGKRLDKFPH

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 28,323
  2. Avatar for Contenders 2. Contenders 56 pts. 27,700
  3. Avatar for Go Science 3. Go Science 29 pts. 27,470
  4. Avatar for VeFold 4. VeFold 14 pts. 27,176
  5. Avatar for Marvin's bunch 5. Marvin's bunch 6 pts. 26,935
  6. Avatar for Void Crushers 6. Void Crushers 2 pts. 26,823
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 1 pt. 26,814
  8. Avatar for Australia 8. Australia 1 pt. 26,465
  9. Avatar for FamilyBarmettler 9. FamilyBarmettler 1 pt. 26,319
  10. Avatar for Trinity Biology 10. Trinity Biology 1 pt. 23,516

  1. Avatar for nicobul 31. nicobul Lv 1 5 pts. 26,114
  2. Avatar for BarrySampson 32. BarrySampson Lv 1 5 pts. 26,088
  3. Avatar for ProfVince 33. ProfVince Lv 1 4 pts. 26,036
  4. Avatar for orily1337 34. orily1337 Lv 1 4 pts. 26,015
  5. Avatar for pizpot 35. pizpot Lv 1 3 pts. 25,980
  6. Avatar for hada 36. hada Lv 1 3 pts. 25,905
  7. Avatar for georg137 37. georg137 Lv 1 2 pts. 25,877
  8. Avatar for vybi 38. vybi Lv 1 2 pts. 25,852
  9. Avatar for Th1sN@me!sN0tAPun 39. Th1sN@me!sN0tAPun Lv 1 2 pts. 25,724
  10. Avatar for frostschutz 40. frostschutz Lv 1 2 pts. 25,686

Comments