Icon representing a puzzle

2537: Revisiting Puzzle 82: Cytotoxin

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
November 20, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for Team China 11. Team China 1 pt. 8,257
  2. Avatar for Street Smarts 12. Street Smarts 1 pt. 7,501
  3. Avatar for I-14 Salt Bridges 13. I-14 Salt Bridges 1 pt. 7,496
  4. Avatar for Androids 14. Androids 1 pt. 7,480
  1. Avatar for meatexplosion 21. meatexplosion Lv 1 22 pts. 9,872
  2. Avatar for JuliaBCollet 22. JuliaBCollet Lv 1 20 pts. 9,795
  3. Avatar for Anfinsen_slept_here 23. Anfinsen_slept_here Lv 1 19 pts. 9,770
  4. Avatar for manu8170 24. manu8170 Lv 1 17 pts. 9,706
  5. Avatar for fpc 25. fpc Lv 1 15 pts. 9,674
  6. Avatar for pfirth 26. pfirth Lv 1 14 pts. 9,634
  7. Avatar for maithra 27. maithra Lv 1 13 pts. 9,607
  8. Avatar for Crossed Sticks 28. Crossed Sticks Lv 1 12 pts. 9,604
  9. Avatar for NPrincipi 29. NPrincipi Lv 1 11 pts. 9,578
  10. Avatar for heather-1 30. heather-1 Lv 1 10 pts. 9,570

Comments