Icon representing a puzzle

2537: Revisiting Puzzle 82: Cytotoxin

Closed since over 1 year ago

Novice Overall Prediction

Summary

Created
November 20, 2024
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin, produced by the Mozambique spitting cobra, induces contracture in skeletal and cardiac muscle. This protein contains eight cysteine residues, which oxidize to form four disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.

Sequence
LKCNKLIPIAYKTCPEGKNLCYKMMLASKKMVPVKRGCINVCPKNSALVKYVCCSTDRCN

Top groups

  1. Avatar for Team China 11. Team China 1 pt. 8,257
  2. Avatar for Street Smarts 12. Street Smarts 1 pt. 7,501
  3. Avatar for I-14 Salt Bridges 13. I-14 Salt Bridges 1 pt. 7,496
  4. Avatar for Androids 14. Androids 1 pt. 7,480
  1. Avatar for EmelendezTAMUCT 71. EmelendezTAMUCT Lv 1 1 pt. 7,496
  2. Avatar for wudooAI 72. wudooAI Lv 1 1 pt. 7,480
  3. Avatar for NGO0610 73. NGO0610 Lv 1 1 pt. 7,175
  4. Avatar for Poresdroesker 74. Poresdroesker Lv 1 1 pt. 7,170
  5. Avatar for alsubaie 75. alsubaie Lv 1 1 pt. 7,163
  6. Avatar for SemperRabbit 76. SemperRabbit Lv 1 1 pt. 5,840
  7. Avatar for lize11123 77. lize11123 Lv 1 1 pt. 0

Comments